DPCstruct | MC23640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 251 ± 35 aa |
| Standard deviation of domain lengths | 35.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07264 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I0ERQ9 | 5-237 | LSILSKSSKDFLSIRMLILNLAPLVVAIAFFGAIFYYYNDNIVSYFESLLPQSLSAYTHSQGIFASLFAWVLKILVYVLIFWIVILL… |
| A0A6I5NJ65 | 15-266 | GGLPGLFIGFTYPLRTLRLLLQQKSLWPYVLTPLAINIVLGITLYTLGVRWGLRLVDNWMLRLTNWLGPAWLDTTVQVLTPVIQGGL… |
| A0A1Q5Q8W4 | 841-1107 | None |
| A0A0G4LLM7 | 722-970 | None |
| A6DFS8 | 22-274 | None |
| A0A0A1T966 | 2-204 | None |
| W2LDC7 | 2-279 | None |
| A0A504Z427 | 50-365 | None |
| A0A287IHG6 | 1-257 | None |
| A0A0B7MZ29 | 4-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.