DPCstruct | MC2364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 16.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 33.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12450 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N6L8Y3 | 278-411 | PSGPVGLATFAPAGQPVAAHAARTGLTSTVANTEDYDHVVDNPFLRVRDEPLSTFSVDVDTASYANVRRFLDHNTLPPVDAVRIEEM… |
| A0A376X0C2 | 102-209 | TARYQQFDDNPVKQVAQNPLATFSLDVDTGSYANVRRFLNQGLLPPPDAVRVEEIVNYFPSDWDIKDKQSIPASKPIPFAMRYELAP… |
| G7TBW8 | 1-159 | None |
| A0A2N1DD03 | 2-149 | None |
| A0A2E9LNW8 | 1-118 | None |
| A0A522SJZ9 | 98-241 | None |
| A0A7W1CL27 | 2-127 | None |
| A0A238TGV6 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.