DPCstruct | MC23639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.93 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 67.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847HBR2 | 1-63 | PWGYGNSLEWATSCPPPRHNFVSLPRIRSERPAFELHYPHMVERMRREAHVTSRDERAEITQT |
| A0A1T8GNK0 | 193-250 | VDDPWGYGNSLEWATSCPPPRHNFSELPRIRSERPAFELHYPHMSERMRAEAHVGGGH |
| A0A0L0KS58 | 331-393 | None |
| A0A1S2PV81 | 74-134 | None |
| A0A1S2PZN6 | 19-71 | None |
| A0A2S6X4E7 | 1-54 | None |
| A0A2S6WZG5 | 1-68 | None |
| A0A7W9WLG5 | 174-226 | None |
| A0A132MUQ9 | 35-99 | None |
| A0A7W0JPD2 | 45-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.