DPCstruct | MC23638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M0WQS0 | 77-179 | QAELEQIAIEIGVNRVLILHQFLDRMLPDKEAIINFPHVELVIDGDGVGANRVKIENYLQYASEPGFEYGGFKLFPTDGDYPVMSPN… |
| A0A847H9N9 | 1-94 | NDLPQKGLIVHQFQMQMLRDREQINTDHPELAFILHADGHGVAEEKFATWDAVRQGLDEDWFMAWKNFIDEDKPTFTPEQTYGIEPR… |
| A0A7Y9DVV8 | 905-1005 | None |
| A0A3E1NUB7 | 572-678 | None |
| A0A1Q9SU83 | 2-106 | None |
| A0A847CNF1 | 106-210 | None |
| A0A535FFL2 | 2-118 | None |
| A0A5N1ADG4 | 471-574 | None |
| A0A5F0GVS4 | 50-142 | None |
| A0A1G8H6X4 | 1-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.