DPCstruct | MC23635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 210 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6T9E8 | 7-214 | RRLALLGALCLALAACAGPVYTTRADPKVVLRELDQSAITSGEPSLPTRNVLYEHGLFEAFDERPAAAIAALHRAMVAAQGDQDMLF… |
| A0A2P2CXI1 | 2-230 | IQRSSVNFLICNRKTIYTILSVVFLLQCGTTYSTITYSKYEQIRAVRENAISSENLSLITTRFLKSNDLYEKYQEAPRVVIYDLDNR… |
| A0A1V5DKJ2 | 20-229 | None |
| A0A1Q7ZBI2 | 1-203 | None |
| A0A109LAX0 | 1-204 | None |
| A0A1G0ZK23 | 3-221 | None |
| A0A6N6XE55 | 7-183 | None |
| H8FED6 | 7-220 | None |
| A0A1D3KAG8 | 9-224 | None |
| A0A1G2WGR4 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.