DPCstruct | MC23628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 18.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 44.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A195C798 | 1-106 | MEEMLFEADCRNALETHKCSFNGLDYLAEILWNRNLRHPSRLYTWQDVFNIPQFKLWLKLHPRPIYPNSWLWTKEEAALHIQRYVRG… |
| U3KHZ4 | 6-141 | LEFYIFPVLLPGLAALLHEAEKEKCFEGKRTKFIPSDFLTEWLYNKNPKRKDESFTELFSIPFVKDWLKDRPRPPIPLSLLLSEEEA… |
| A0A2H1BW47 | 3-113 | None |
| A0A7J5YAA2 | 93-249 | None |
| A0A4U1FFR2 | 13-133 | None |
| A0A665V443 | 2-138 | None |
| A0A6P4XIT0 | 81-223 | None |
| A0A7M5X4Q8 | 24-171 | None |
| W5M4S8 | 2-146 | None |
| A0A5J4P138 | 54-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.