DPCstruct | MC23625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.37 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 23.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M3LSI4 | 17-118 | GHNDFIPMCLEEMELHSAKNADYAKGGDPLGNFKRVSAILKVWGYNIPPYLVALIYALKQQDAYMWMLSQGYEGQVEGVASRLQDDS… |
| A0A7W1QLZ6 | 3-122 | KINREALFALHKQICAECLVIMEMKNRDYAGHKADADPFANFRDSGTLLNMHPGKGLLIRVIDKFKRITSFIDAGTLAVKDEPVQDA… |
| A0A177Q524 | 1-101 | None |
| A0A7V2EE02 | 1-116 | None |
| A0A7J2R3N3 | 1-122 | None |
| A0A0F9T4M8 | 1-107 | None |
| A0A1V5X467 | 6-117 | None |
| A0A0F9A2F9 | 6-109 | None |
| A0A0F9W8A9 | 1-113 | None |
| A0A3E4M1A9 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.