DPCstruct | MC23622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 194 |
|---|---|
| Mean domain length (aa) | 279 ± 57 aa |
| Standard deviation of domain lengths | 57.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 43.59 |
| Assigned Pfam label(s) | PF13884- PF13018- PF05658 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7KZ27 | 284-564 | DNTSAGSNSLYSNTTGSDNTATGSNSLYSNTTGTNNTTSGSNSLYSNTTGSDNTATGSQSLYSNTTGLNNTASGFKSLYSNTTGYDN… |
| A0A7W1MTQ7 | 8-255 | VTRATIPPLGFHALYANAGAFDNTGTGSQALASNIGGLDNTATGNDALFMNTDGDFNTATGSSALFNNLTGDSNTATGAAALFEHVS… |
| A0A1Q7FM29 | 42-235 | None |
| A0A6J4GPP3 | 227-512 | None |
| A0A418MF44 | 632-882 | None |
| A0A1Y6FEP4 | 307-566 | None |
| A0A4Q8RNX5 | 17-291 | None |
| A0A1F3K1R2 | 376-616 | None |
| A0A3C1F5X5 | 143-454 | None |
| A0A1G1A1M8 | 3-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.