DPCstruct | MC23621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 580 ± 53 aa |
| Standard deviation of domain lengths | 52.60 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | PF21088- PF12607 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A380Q5V9 | 252-887 | LILSEKTVKEAQAQTDGSDIQNDPLISRELAINKELSERLINATKEGNTLVQQNIRVKNWLDRALQSERNLKEQITVLRGSLLLSRI… |
| A0A7W1CTG9 | 12-509 | LGFAGPLAAAAEPTPSPGATLAAASPTPALEPTPVPLADVVLQADAAEAGLQEMLPAADAAAANAVGRDLPAVKREISALLTETTQL… |
| S7TWM7 | 4-598 | None |
| A0A523GUE4 | 3-564 | None |
| A0A379AIL5 | 1-451 | None |
| A0A1X7DFZ4 | 1-585 | None |
| A0A7T9C7T0 | 321-892 | None |
| A0A2E0TE87 | 482-1073 | None |
| A0A537PH86 | 6-601 | None |
| A0A380N168 | 168-780 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.