DPCstruct | MC23620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1CSR9 | 1-161 | MNASSMRRLLRRTAFLLCLLAFALSGPRVAANPVGDFFKKVGHSISKLGKKSPPKAKSKKAKNSGAKSEKSAGATPPEITPSPTPDA… |
| A0A2E9H9J2 | 1-133 | MKTKHIFLSLALISALLSSCYYPYPPNPNGPRGGYPGPNENSDLTSEEQEGIREARDKAREGEAGDNPSPEPQDPASNPPARKDYRV… |
| A0A4Q2Y9T2 | 44-190 | None |
| A0A366HMZ7 | 48-162 | None |
| A0A2V6B0C8 | 21-170 | None |
| A0A4V3FFL0 | 138-253 | None |
| A0A4R7SPR6 | 3-166 | None |
| A0A2A2QXT6 | 1-145 | None |
| A0A1Q6VFL8 | 2-116 | None |
| A0A2A2QJH1 | 1-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.