DPCstruct | MC2362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 63.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S8IMD2 | 343-423 | PILDQMLLEQTTENVVWTPSKVIVRLGKEINDESSYLYWAYKNNVSVYCPALTDGSLGDMLYCHSVRNPGLLIDIVQDIRA |
| A0A6P5HN42 | 1-76 | MLTLDTMLAEQEEKDMIWTPSKVIARLGVEINNEHLIYYGAEKNNILVLSSTLSDGNLHFYRNPGLIIDIISDLNL |
| A0A259J9L3 | 297-381 | None |
| A0A813VPC6 | 226-302 | None |
| A0A1P8BA27 | 2-76 | None |
| A0A453DTU1 | 238-316 | None |
| A0A4W6DZN1 | 55-132 | None |
| A0A368FQR2 | 35-113 | None |
| A0A835N9P5 | 1002-1083 | None |
| A0A433QJP8 | 740-817 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.