DPCstruct | MC23615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.12 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04968 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S1JPE1 | 59-129 | TKSGRYKCCNGGCNQEYEPDENHDTACRYHPGKPIFHDLKKYWSCCSNIVKYDWDEFMQIEPCAIGRHNPK |
| A0A7E6E0A3 | 18-95 | KMALLCYNQGCGQCFDPETNSDSGCTYHPSVPVFHDALKGWSCGKRRTTDFSDFLSIKGATKGKHNSEKPPEPVKPEV |
| A0A287AFZ8 | 2-78 | None |
| A0A0D8X748 | 47-142 | None |
| A0A1Q9CBQ6 | 63-139 | None |
| A0A0C2I5R3 | 2-82 | None |
| A0A0P1B024 | 90-170 | None |
| A0A2K5N8X5 | 1-82 | None |
| A0A4S9M4H7 | 63-151 | None |
| A0A395STC6 | 89-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.