DPCstruct | MC23613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 88 |
|---|---|
| Mean domain length (aa) | 115 ± 25 aa |
| Standard deviation of domain lengths | 24.94 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 99.14 |
| Assigned Pfam label(s) | PF03172- PF01342 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183DTL4 | 3-75 | LFQVRCGQLVARLHVEKFVCPGIHQPCIELDGELISPKEFTVRANKDKQKDWKGSIRIGKSNMRALMEMKTLD |
| A0A7E6DPQ0 | 16-127 | DSAKYENGGEPLKASTPAVKRKTGTGQQPGVNVNFEAEILPVTCKENMGLLIKRKLERGATRKCIRIEDGNWFTPGEFEIRGGHEKA… |
| A0A670IJJ5 | 465-549 | None |
| M3W7Z9 | 461-588 | None |
| A0A6P7DQY2 | 509-645 | None |
| A0A669DEE8 | 1-88 | None |
| A0A7M5UYH2 | 165-336 | None |
| A0A6S7FWD6 | 107-232 | None |
| A9JR84 | 11-156 | None |
| H3BC61 | 4-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.