DPCstruct | MC23612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 374 ± 49 aa |
| Standard deviation of domain lengths | 49.43 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 68.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 19.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14922 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R2CPC2 | 2-301 | KSEYEPLPDNVISNLNRVIDNVGKDKKPKKLWMKYFKSHENISIISNFFWYYLCKLLHNSKYISIEEQLLDRIAVKYVELYVSVEAN… |
| A0A7E6D8B1 | 2-375 | VDNVVQSERSTLSGKSFCSQRELEKYLSSPSLRAIWLDSFWWIFHERFQPNREVQNKLFDRIAQHYASLLFHGSRSHYEEAVLKRLP… |
| A0A6A3UNQ7 | 100-515 | None |
| D7FSU1 | 1-489 | None |
| A0A1Q9DPA7 | 117-542 | None |
| A0A7J6TYR4 | 1-410 | None |
| A0A1S3FV42 | 49-446 | None |
| K7F8X1 | 34-416 | None |
| A0A2T7PX86 | 184-470 | None |
| A0A5D6XYP3 | 195-512 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.