DPCstruct | MC23609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 82 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12005 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0KXU8 | 1-65 | MLRHCSRPGCGERAVVTLTYQYGRSQVWLDHLRPERDPHAYDLCHRHATRLSVPQGWHLDDRRPP |
| A0A6L5FV73 | 2-80 | SQCSKPACSAPGGVILGYDYAARVVILEDPPEGMISPHLYLLCVDHADRLTLPYGWTLDDKRFQPALFTDEFSALGPSL |
| A0A6I5VF51 | 2-79 | None |
| A0A7V9SMW2 | 3-65 | None |
| A0A0X3Q955 | 9-105 | None |
| A0A3D3QDG6 | 1-72 | None |
| A0A6I2WQX6 | 1-91 | None |
| A0A316B1H8 | 2-60 | None |
| A0A1T5KH73 | 46-110 | None |
| A0A1X7FWI1 | 1-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.