DPCstruct | MC23607
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 188 ± 47 aa |
| Standard deviation of domain lengths | 46.83 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.05 |
| Pfam Score | 68.47 |
| Assigned Pfam label(s) | PF06750- CL0130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T7MA30 | 50-228 | LPQALLALAATAASAWWVWRTEAGWMGLVALPVIALLGVAASTDAVCHRLPNRLLLAAGAWVTTALVALAIARAVAGAPLPEAVWPL… |
| A0A844XG06 | 3-143 | LIGALVLAAFACVAAIWDIRSRRIPNWLNLCVLVGGIIMIAVNWSTAEPLSHLMHFGLALAGAMLLFALGLWGGGDAKFYAATAIWF… |
| A0A2L2XCN4 | 96-266 | None |
| A0A6L7SU22 | 103-322 | None |
| A0A6N3UL60 | 2-154 | None |
| A0A535VX67 | 65-259 | None |
| A0A556UT24 | 4-148 | None |
| A0A838YXY3 | 35-234 | None |
| A0A0R2FT74 | 12-169 | None |
| D4YPE7 | 48-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.