DPCstruct | MC23606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 52.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A077KSA4 | 28-87 | MQQAIVGFHLDEEQHYVAELACGHQQHVRHLPPWQNRPWVLTEQGRQEKIGMFLACKTCD |
| A0A1Y0CWH3 | 13-75 | NKRLTKQPILAFYSSKGEQWRVELRCGHHQLLTHQPPFHQRPWLLSPALRHAMVGCWLPCKEC |
| A0A7Y7WRD3 | 1-65 | None |
| A0A2G2QN97 | 1-60 | None |
| A0A7W1EK01 | 1-67 | None |
| A0A4Q5XCJ5 | 1-59 | None |
| A0A518CM08 | 1-64 | None |
| A0A7W1N6V0 | 1-61 | None |
| A0A5C6D5P5 | 1-64 | None |
| A0A3G7WUA1 | 2-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.