DPCstruct | MC23605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 172 ± 23 aa |
| Standard deviation of domain lengths | 22.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5V5I9 | 41-173 | VPDGCNLAFTIASVLPKCAYKEEWEPKERFTDAYISTQVQVLDYLSKHAADELTVAQAYFFTENAGTKPYGPTAKQAVEICYFMRSF… |
| A0A177CWQ7 | 18-216 | AAAPPTPAHDLPVLPQIDDIDPDNEYLHSLRSIFAPSFDMSNPFAQSSRRRHVPFTVASVLPRTDYKEEWEPKERRSDDYLAMQIDI… |
| A0A2V1DI82 | 95-264 | None |
| A0A6A6ZVQ7 | 39-190 | None |
| A0A6A5WIK1 | 2-179 | None |
| W6Y3D4 | 1-184 | None |
| A0A6A5Y4X7 | 15-213 | None |
| A0A163E942 | 140-295 | None |
| A0A6A5RCY2 | 6-153 | None |
| A0A364NFD5 | 70-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.