DPCstruct | MC23600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 139 ± 12 aa |
| Standard deviation of domain lengths | 11.79 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833D6H0 | 7-134 | VLAMAMAVALVAAWPVCAGQLEPAACDKAKADQAALISAGVKEDMAKGPEWAAKNLSPERIARIKSYLSLEEDIRFRCPQPKPPRPE… |
| A0A524KL29 | 1-132 | MAILVSAAVTGLGSVAVAEPLDKESCAKLQLERKQLLNKDMQAALDRGPDWVKENLTEEAISRVRHFLKVEEHIQFRCRGGGVAKQV… |
| A0A3C1NF85 | 38-165 | None |
| V5SHU8 | 1-139 | None |
| A0A6N0DU32 | 3-117 | None |
| A0A120CW86 | 4-162 | None |
| A0A849TLQ8 | 1-152 | None |
| A0A2S5MEK3 | 8-147 | None |
| A0A7C2LZ80 | 1-142 | None |
| A0A1E3W574 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.