DPCstruct | MC2360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0SSG4 | 194-255 | EVYKYGKYTLYTRKVKLVRGKEVDIYFFSSRKPKSGTQCPIPEGYEVGVSKRSNMPFLRKKK |
| A0A0G0LZH4 | 18-86 | GDDMAYEYTNAKGTKYYLHRREVTLRGSGKVQRIYFFAKEPKDGAIDEIPEGYTVVENPRTGLPILKRA |
| A0A662TSV1 | 2-76 | None |
| M7TFN8 | 1-64 | None |
| M7U0I4 | 5-69 | None |
| A0A7J2S873 | 212-274 | None |
| A0A7J2SQY2 | 27-87 | None |
| A0A6J4K9H6 | 2-62 | None |
| A0A6N1YAB3 | 1-62 | None |
| A0A660M8Q8 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.