DPCstruct | MC236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 154 ± 18 aa |
| Standard deviation of domain lengths | 18.10 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 17.17 |
| Pfam Score | 41.67 |
| Assigned Pfam label(s) | PF19425- CL0187- PF08525 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8PLV9 | 14-132 | KTNYKVGKLYSLPIDADLLKSQPSQNQSRVARWANYTVRSGESAAVLFQRIGLSPSLLHQLVTSNDDINKQLSRLRPNDELHFGFDA… |
| A0A2V9IBJ9 | 1-156 | MAEEPGLRNTAFASSLWQRGSIFITLLATITALVTGGGYLILERGRPFGVARKQPLPIPTPSPQLIPAVPRREVVGTFSARQTLADA… |
| A0A523LE70 | 23-187 | None |
| A0A378VVY5 | 1-152 | None |
| A0A4Y9EME4 | 56-228 | None |
| A0A0M6W8A1 | 4-178 | None |
| A0A2G1YUN4 | 1-120 | None |
| A0A1H4PIY9 | 129-308 | None |
| A0A2E2EJZ9 | 13-161 | None |
| W0HMX0 | 97-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.