DPCstruct | MC23598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 234 ± 48 aa |
| Standard deviation of domain lengths | 48.37 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.47 |
| Pfam Score | 75.21 |
| Assigned Pfam label(s) | CL0123- CL0257- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q977W4 | 95-277 | LDWVGSSFVSELKVLNFWLRNGFTPVYLASRKNEGLGGYSIIVLKGMSEKGKSITSFLSANLKDKILRTSHQVYFNVSPLVLVKILR… |
| A0A023B9F2 | 67-322 | KRFIVSVPCSSVPGLKLAKAVGLAPVLVHWAEDVHSPQVPSLLVPQVLFVGGSMVSAAPSEIQPLVEDFRSSLCLLCSSTLSPVATR… |
| A0A803KW85 | 26-264 | None |
| A0A7S0TGS0 | 2-283 | None |
| A0A847BIR0 | 331-538 | None |
| A0A0P7HAN4 | 267-497 | None |
| A0A1S8VHW3 | 13-260 | None |
| A0A655TCE9 | 34-247 | None |
| A0A7R7GDE8 | 416-628 | None |
| A0A6A4VK79 | 70-332 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.