DPCstruct | MC23592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 375 ± 43 aa |
| Standard deviation of domain lengths | 43.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023B2K1 | 36-369 | LVRNYWRTLNESEFNILMQDVTAGRSARSQECARRWSQFYYQMPAEERSKWTTGGEDPERSFPLYIPTLGTMTNTSRKIGIFSDDFR… |
| A0A023AX03 | 109-418 | KKNYESHWTSRFWIPLDETGFELLRSVAATKPYYRRGIWTRRGAAFVDFIRRSGGHSWALTTGTETIRPNYIPVLSRSRRLTKPAES… |
| A0A023B716 | 350-705 | None |
| A0A023BAQ2 | 468-822 | None |
| A0A023B9Z3 | 187-563 | None |
| A0A023B9X4 | 3-452 | None |
| A0A023BAQ8 | 473-857 | None |
| A0A023B9V3 | 61-453 | None |
| A0A023B9U6 | 1-425 | None |
| A0A023B8G5 | 513-857 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.