DPCstruct | MC2359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 188 ± 24 aa |
| Standard deviation of domain lengths | 24.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0010- PF04254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832T248 | 1-152 | LMVKFKEPLIVSPHDSLAGFIEAPIEIDVKVGGLSVDHLLVGREKYALYGALEAGVICRYHVSPFYLKEPDSIGAAKLIVSNPSPEW… |
| A0A7J7BTK4 | 31-235 | IHDVNFGFPEPVHVERYMFRETHKTFQLMPRLADRSVVIRPVDPIYIPAGQRGTLYISTPLWISGFVQAQKEPLFDIPVILPKDTWF… |
| A0A345UIQ8 | 24-263 | None |
| A0A662P788 | 9-202 | None |
| A0A1G3YY23 | 1-175 | None |
| A0A6C1NUG8 | 28-239 | None |
| A0A7K3YTW8 | 1-145 | None |
| A0A4P5XU37 | 23-204 | None |
| A0A2A4M4Q0 | 75-255 | None |
| A0A7J2UUV4 | 102-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.