DPCstruct | MC23589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 196 ± 16 aa |
| Standard deviation of domain lengths | 15.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023AXN4 | 343-547 | TVDGWKEVDWRACSELGGKVVCRRDEDLLCYYFGSPWNYGLPSVWEGVARYHRPNRCSFECNSPGEHERLLQERLGKQWSPAFPSLK… |
| A0A023AZ75 | 19-197 | AIPPPLSTCGSGVLYCGSCDNFGTGPTQIAFGSPWPVSFPLAWNIAHGFFREKCEVNCFPHDGMHLFSRLLDYFPLGTPTDGHMSRK… |
| A0A023B2G6 | 500-709 | None |
| A0A023B5P9 | 149-367 | None |
| A0A023B563 | 237-457 | None |
| A0A023B555 | 625-836 | None |
| A0A023B507 | 150-356 | None |
| A0A023B4M0 | 433-626 | None |
| A0A023B4G6 | 12-196 | None |
| A0A023B482 | 17-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.