DPCstruct | MC23588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 224 ± 29 aa |
| Standard deviation of domain lengths | 29.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023AXK3 | 1-203 | MRGLKGELSGVSGSELLSILLASDGSKPELDNCVAQVAAIEIGDSSVMAVALAPRDVFETDGKPASVSGLFHACWSRMMVWRPEGAK… |
| A0A023AZA4 | 21-224 | MSGDGSRREIRDCVAQIVTIRTGSGNVAAVVLAPKTAFYMESEVVNETTPLQTPAPLQTPAADWYEHWDRMTVWRPTRGRSSNKYAE… |
| A0A023B548 | 1-194 | None |
| A0A023B3N0 | 1-281 | None |
| A0A023AZC8 | 1-219 | None |
| A0A023AZD6 | 1-223 | None |
| A0A023AZ74 | 1-261 | None |
| A0A023AY68 | 1-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.