DPCstruct | MC23586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 121 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 38.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03912 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3NKG8 | 29-161 | QTWPRRNNVLFSGEAPTQAGIQFYPGVYEPNVPDVKLTRSVDAQTGTATFYFDEPSFFNIEKEEDIPKEAITAMTMVDEEGSMQTAN… |
| A0A7S2TF83 | 96-202 | HREASIQFKEGLDEDTVPDVLLFRSPGGEEGTAIFRFTRPTFYNHADVEQEVDGMAMIDDEGSIEAREVAVQFDSRGVPREIEAKYK… |
| A0A3R5QLN0 | 3-114 | None |
| A0A3B6N0F2 | 89-223 | None |
| A0A7S1KG82 | 2-97 | None |
| A0A7S1KI19 | 58-191 | None |
| A0A4D9BCJ7 | 5-118 | None |
| A0A0A0K9C2 | 244-370 | None |
| A0A3R5QME7 | 2-107 | None |
| D8TJ97 | 1106-1235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.