DPCstruct | MC23584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 230 ± 60 aa |
| Standard deviation of domain lengths | 60.13 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 74.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 27.97 |
| Pfam Score | 94.07 |
| Assigned Pfam label(s) | CL0182- PF03105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9PDQ7 | 3-193 | AMLYLVVEEAPSAESVEPEIITRHFANFDEHFFHFCDSELKKINTFYSEKLAEATRKFATLQNELQISLANRASAKNKNQGKPRIQT… |
| A0A182H5L7 | 154-355 | RTVHEYEMKAQLYAAVEQSPSAELVDPEVLTRYFAKFDEQFFHFCDSELAKINTFYSEKLAEATRKFANLRTELSETLELEESTKKK… |
| A0A2G4SKE0 | 24-206 | None |
| A0A2H1BZC7 | 1-272 | None |
| A0A1C7M5B4 | 1-222 | None |
| A0A183SPM8 | 1-281 | None |
| A0A7S0GC00 | 2-297 | None |
| A0A2H2IV39 | 110-278 | None |
| A0A6F9AL34 | 46-238 | None |
| A0A1B0FK38 | 16-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.