DPCstruct | MC23583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 315 ± 42 aa |
| Standard deviation of domain lengths | 42.31 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G2ZV77 | 119-387 | EYEKTNTTETMDNAVSAFKEIGTLRKTDPIGIDDIEYQYISFIQELTQEKDAQYNLTMDDDILTAIDDIQNDNAPTLAGEVIDKTLQ… |
| A0A6S8BKD8 | 569-866 | YAPVSDVTDHAMIDLDVADMSNALNAVEWDSAWNAYDLGGNSEKGDAFRTLRGFSKDLSGEPTYDEFIAYHDGDALYADKYVRAALW… |
| A0A7S0UKB0 | 247-563 | None |
| B7FYL4 | 301-646 | None |
| A0A7J7QCW4 | 1-242 | None |
| A0A2E5AKW3 | 174-480 | None |
| A0A1Z9AXU9 | 27-297 | None |
| R1CT70 | 310-660 | None |
| A0A7R9WTT1 | 3-271 | None |
| A0A7R9WN33 | 16-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.