DPCstruct | MC23582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 446 ± 103 aa |
| Standard deviation of domain lengths | 103.47 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 24.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5J336 | 28-440 | TTIEGYSSWTNSEPLCGLEKRGKVRRFVLRKTHAINCRVSLAPDFSAWEDTPNNGITLLVLAWSYILTADLAERQCLGMEYLPRQPS… |
| U4LNI5 | 102-543 | EFSPTVPKDPDTPCNVHIVYIPGRNSEAVRWWKHVLGSTPGWQVTLQYRETQYQSPWAIRGPTGKDVHFRVLSQAKPQAGKPAATPP… |
| A0A084RJ01 | 287-834 | None |
| A0A370U065 | 69-655 | None |
| A0A5N6XC31 | 1-493 | None |
| A0A395T3V2 | 746-1228 | None |
| G3JG95 | 63-566 | None |
| G3JSZ0 | 216-731 | None |
| A0A2V5HVP8 | 9-511 | None |
| W6Q803 | 3-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.