DPCstruct | MC2358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 20.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 67.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7BRP8 | 43-205 | LNRVSSRDTTETAYTSDTLKLPAPDFIDSSVSKTSVFTNPFKQAEDAKQAILEKHVKMVNAKDNTQIINGKKVCWNYRKGKCRFGHN… |
| A0A195C631 | 4-139 | TETTASKEKLPLPTPDFNSASTLLRTSVFLNPFVEAERAKSAILEKHVKMTPTLDDTKMINGRKICWNYRKGRCRFGHNCTFAHDSD… |
| F6Q2S6 | 1-160 | None |
| A0A6G0TWN8 | 28-171 | None |
| A0A4Y2J3Z2 | 1-117 | None |
| B4H9N8 | 1-133 | None |
| V4C6G8 | 37-219 | None |
| A0A0S7LJ79 | 60-241 | None |
| A0A4Z2HA78 | 64-240 | None |
| A0A7R8VUA6 | 12-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.