DPCstruct | MC23576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 185 ± 21 aa |
| Standard deviation of domain lengths | 20.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5XHY4 | 6-156 | IEMNDLDKHPNFLAEKYLRKNLPSLNKPRIFYETLVIETKSINIVHRHRGENANTIAFSKIQILNVISLEEWDPSPERDYKKAWEYV… |
| A0A830BS68 | 2-161 | YQAILEDNDSAFFKHFKEKEETTYSTCKILRGLAPSEWKHSISAPIRLSQKYAENSWAFIPYNYWDYQQAWFNSFFIQNKNEKHSWL… |
| A0A836J305 | 506-699 | None |
| M1DWK7 | 18-203 | None |
| H2KWE4 | 161-366 | None |
| A0A151T5L5 | 6-164 | None |
| M1DZ48 | 530-706 | None |
| A0A3S3NGC3 | 302-513 | None |
| A0A2N9IG48 | 1-216 | None |
| A0A5N6P372 | 77-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.