DPCstruct | MC23575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 213 |
|---|---|
| Mean domain length (aa) | 112 ± 20 aa |
| Standard deviation of domain lengths | 20.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.98 |
| Pfam Score | 98.00 |
| Assigned Pfam label(s) | CL0109- CL0617- PF13963- CL0219- PF13960 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843UG12 | 66-150 | LDKSWMKLKDRLDPRYEKGVNELLDFAFHEDRRNFRHGDNGQLIQCPCKNCRISGKLSRYEVKTHLICDGIWLHYTNWVCHGEEP |
| M5XAP8 | 1-112 | MDKSWMHSDRRSKAYEFGVEAFLNFAVENLLTTTHILCPCVKCVNLKLFGVGIIRDHLYFNGIDQSYKNWTFHGEPWEATTNASRNV… |
| A0A7C9EW89 | 4-128 | None |
| A0A251T494 | 51-184 | None |
| A0A835GVF3 | 68-151 | None |
| A0A835HK52 | 162-260 | None |
| A0A835HLJ1 | 2-89 | None |
| A0A5D3DBP2 | 295-383 | None |
| A0A0D3GYD0 | 6-142 | None |
| A0A1U7WMS9 | 4-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.