DPCstruct | MC23574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7465 |
|---|---|
| Mean domain length (aa) | 149 ± 28 aa |
| Standard deviation of domain lengths | 27.55 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.45 |
| Mean intra-cluster sequence similarity (%) | 14.19 |
| Pfam Score | 75.44 |
| Assigned Pfam label(s) | PF18701- CL0194- PF05380- PF02238- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A1IXB0 | 4-119 | ERGIATDGAHSMKRGVTRYRAVDLGTGELLFEQNIGNQTINIGEFLGVVEAAKYIIEHRFSPAIIYTDSLTALTWFNEKRTASRKRN… |
| M5WZF6 | 21-165 | IFNRAHHLAEKSTKWSPPPAGKYKLNVDAAFIPETGVGGIGAVVRNDKGEVMAAMALPLASATSSKHAEIMAFLFGMKFARDAGCSS… |
| A0A2V1DED3 | 43-183 | None |
| A0A2C9VZN5 | 210-322 | None |
| A0A1I3ZA38 | 4-155 | None |
| A0A0R3URP1 | 12-186 | None |
| A0A1R3KN67 | 11-151 | None |
| A0A803QCN7 | 288-435 | None |
| A0A1M7AVM0 | 52-188 | None |
| I1CM16 | 88-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.