DPCstruct | MC23573
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 63 ± 5 aa |
| Standard deviation of domain lengths | 4.86 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 50.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090T0A3 | 11-68 | LKWVILGVGFAFLYLPILILIIYSFNENRLVTVWSGFSFKWYFELLEDDLLMGGVKLS |
| A0A7X4WVM6 | 1-67 | MGRFFKVSLMSVVYAFLYIPIIILIVNSFNASKFGMKWGGFTTKWYEQLVNNDSLMQAAWHSLNIAV |
| A0A4P0Y5S7 | 3-67 | None |
| A0A2P9H1C5 | 3-62 | None |
| A0A6M1HUG2 | 3-56 | None |
| A0A376F5N1 | 1-68 | None |
| A0A3S4EVN0 | 3-67 | None |
| A0A6D0F6V2 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.