DPCstruct | MC23572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 554 ± 43 aa |
| Standard deviation of domain lengths | 43.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1DD92 | 1-537 | MSYLGFPRLNFAGTIQTDVATANNVPQYFDNDLFEPRFQRRMDLPDVNGLWNPRGPGTLRLADVAVTSVCLPDGRRLTDGRADPVVG… |
| A0A7X4WTL5 | 2-528 | SYLNNLRMVFSGRFQSDVSTVNNDVRHFDVDKFVPEYQEYGKGAINGWWNPCGSGAFRLIDCRVTQVGYQDGTTTSDPAKEPVIGML… |
| C3XQ70 | 11-490 | None |
| F6QM76 | 6-559 | None |
| A0A7D9LIS8 | 313-843 | None |
| A0A654LWD9 | 1-624 | None |
| A0A2G0CHS2 | 25-572 | None |
| A0A1S3JJ99 | 33-614 | None |
| A0A2A5HS86 | 1-628 | None |
| A0A7K2YLM6 | 1-504 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.