DPCstruct | MC23571
Metacluster Properties and Pfam Annotations
| Number of structural domains | 122 |
|---|---|
| Mean domain length (aa) | 500 ± 105 aa |
| Standard deviation of domain lengths | 105.27 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.85 |
| Pfam Score | 98.83 |
| Assigned Pfam label(s) | CL0552- CL0167- PF00995 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0TTV1 | 27-445 | EWKVLVVDHSSTRILSSCFKMSDLLAEGITIIEDINKRREPLPSLEAIYLISPIETSVQALINDFKGTPTFTYKAAHVFFTDTCPDN… |
| A0A7N1A7B2 | 3-466 | AVYFVQPTRENVIMFLSDMAGKSPLYKKAYVFFSSPISRDLVGQIKRDPTVLPRISALREMNLEYFAVDSQAFVTDSERALEELFGD… |
| A0A0V0Y2Z6 | 538-1075 | None |
| R0KNP7 | 183-673 | None |
| A0A7J7IQ97 | 4-332 | None |
| A0A7J7IJ86 | 503-1174 | None |
| T1GTR7 | 5-317 | None |
| A0A7M4FPG8 | 640-1115 | None |
| A0A7J6UI94 | 51-349 | None |
| A0A5J4YIS4 | 303-648 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.