DPCstruct | MC2357
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 270 ± 14 aa |
| Standard deviation of domain lengths | 14.21 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 79.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.33 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF02308- PF13194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1UTS4 | 197-476 | LGDEDLRAIMQFALITGIILPVLPNESYGPFGVWNPFEIWLMVVLIVGISLAGYITYKFFGDRAGVIVGGLLGGAISSTATTVSYAR… |
| A0A7J7BGP2 | 1-264 | MTKHSMHGIAGKWITESEFRDGIFLLALLLIALPLTPNKPLWGSVLNPYVILKLLTFNCWLCKHLAHIAKRLLSTKNALLLSSLASG… |
| A0A521TA22 | 121-366 | None |
| A0A1E3W6N3 | 93-380 | None |
| A0A1D2RA11 | 25-311 | None |
| A0A3E0NWI3 | 27-301 | None |
| N9PKH5 | 2-256 | None |
| A0A7C5B994 | 302-575 | None |
| I0IN93 | 148-432 | None |
| A0A1G0JEH7 | 257-506 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.