DPCstruct | MC23568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 121 ± 21 aa |
| Standard deviation of domain lengths | 21.43 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 42.43 |
| Pfam Score | 97.92 |
| Assigned Pfam label(s) | CL0010- PF08059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8RWC3 | 114-257 | FQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGKTGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKC… |
| A0A6F9BXV7 | 45-162 | GDEVHVQQGLPQAWPHSPGTGTIQKGMPHKCYHGKTGRVYNVTQHAVGIIVNKQVKGKILAKRINVRIEHVKHSKSRDSFLQRVKEN… |
| L9JF13 | 1-125 | None |
| L9JER5 | 15-114 | None |
| A0A2E5ICT2 | 1-129 | None |
| A0A7J7GBQ5 | 6-105 | None |
| A0A7G2E1N6 | 357-484 | None |
| A0A812P327 | 4-145 | None |
| A0A822DKD6 | 1-80 | None |
| L9KFB7 | 2-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.