DPCstruct | MC23557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 165 ± 33 aa |
| Standard deviation of domain lengths | 32.58 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11539 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A168PIR5 | 3-160 | VIISNNAKKHMKVHETDFVVNWKELLKKCEIEGKFDSLNKSFEIVKIEFEYNIGYCKCIQTKPEDEIVFAKRTGREIYSRLVKNRRA… |
| A0A2D6KTH8 | 27-177 | NVPGSYFKKDIFPTSKDLIDFAIKQIDSYHGRKKVINIKMNKIIGYDSIISKNKVPSGIKIIRKKREKEGFYFNFVKGLNKKPTKNL… |
| A0A1F6ZS74 | 265-384 | None |
| A0A1G2M9I0 | 19-231 | None |
| A0A3D1WQY8 | 146-280 | None |
| A0A5D6XN64 | 354-550 | None |
| A0A7S1JG35 | 171-368 | None |
| F0WKX6 | 228-422 | None |
| A0A0A0DB30 | 9-147 | None |
| A0A1J4RW32 | 17-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.