DPCstruct | MC23552
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 155 ± 14 aa |
| Standard deviation of domain lengths | 14.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9AR68 | 105-269 | VCCFAYLQPLISKSAKTLETFQNLLLYCSLRAHVWPLAFEYLRWFHTLSVNNHPLLPPLDRDLLFTRIFNAMNFVFCHSQNVSYHRY… |
| A0A1J1HZV8 | 1-162 | MSSRRLQSHIREIDFIGTIACLYNKEETYGYNKIREFFNTDRDKPRFWILFNLIIYHTQDSRFNRFVMRLFEKVSPFTTKVPPIVYM… |
| W2SIT0 | 325-490 | None |
| A0A821FVE3 | 424-560 | None |
| A0A3P7J1S5 | 1-174 | None |
| A0A0V1KW84 | 327-465 | None |
| A0A2U3Z924 | 90-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.