DPCstruct | MC23551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 152 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.37 |
| Pfam Score | 90.07 |
| Assigned Pfam label(s) | CL0614- CL0466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J1HYE8 | 1-151 | MMASEFDPVLSKLLTSLNEADNKLSGEQELQFLQSLLQSKEINALVNVHHKVAKIGKDDRIAPVLSASMQVALEILELLAPRCHISP… |
| A0A2C9LNG8 | 1-168 | MPVNLPLFPHVKIDTDAQKLLVALPTLESRLPNKEPEIHYLRRFLRNRNLHLILRIYRQFRSQQGSKKPAANFAVSQAADVFCEIRY… |
| A0A835P4W6 | 1-148 | None |
| A0A2I4C2T7 | 1-148 | None |
| A0A498NL33 | 93-271 | None |
| T1GU73 | 1-155 | None |
| A0A833VJG5 | 1-163 | None |
| E2ASK9 | 1-148 | None |
| A0A452DKW5 | 2-139 | None |
| A0A2U3ZY57 | 244-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.