DPCstruct | MC23550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 94 |
|---|---|
| Mean domain length (aa) | 243 ± 39 aa |
| Standard deviation of domain lengths | 39.11 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3KZD4 | 2-171 | AKLEEAGIPTQMEALLSDNEVLVKKLDMVPVECVIRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAMHDPMVNESYCETFGWVSK… |
| A0A1J1HQD6 | 16-259 | NEGKTKQIFDLPDHPGLVLLMNKDRISAHNGVRMDDMEGKAMISNQTNAKVFELLNLAGVKTAFVKLASEKAFLARKCEMVPIEWVT… |
| A0A3L7IF28 | 55-293 | None |
| A0A3M7DPR6 | 231-510 | None |
| A0A1F6LHR9 | 440-722 | None |
| A0A0B3AHJ6 | 27-318 | None |
| A0A496PN68 | 428-708 | None |
| K2D5C0 | 332-562 | None |
| A0A849W5J5 | 19-285 | None |
| A0A2V1D7H5 | 238-519 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.