DPCstruct | MC2355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 345 |
|---|---|
| Mean domain length (aa) | 233 ± 69 aa |
| Standard deviation of domain lengths | 68.57 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 21.11 |
| Pfam Score | 90.72 |
| Assigned Pfam label(s) | PF10232- CL0063- PF09298- CL0032- PF02615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L8HZY4 | 7-337 | AWCEARATLQKMLSASEATLKDDVGLRQKAFVPQNKAKMHLPARIGDYTDFYSSKNHAYNVGCMFRGPENALMPNWTYLPVGYHGRA… |
| A0A7J7B617 | 296-578 | SRTCPRLHALSESLNNDSADGVFDLDHQALAAPLPRAYEFVDGSAYLPHVERVRRARNAEVPASFYTDPLMYQATSASFYGPRDPVC… |
| A0A2H3G5Y6 | 47-271 | None |
| A0A4Z0YTF3 | 797-1115 | None |
| A0A819NEE5 | 14-197 | None |
| A0A6V8HJG0 | 633-1013 | None |
| A0A160U7I9 | 2-165 | None |
| K8EPP4 | 144-420 | None |
| A0A672UMV8 | 71-276 | None |
| A0A3E0DNT3 | 30-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.