DPCstruct | MC23549
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 71.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 45.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BMS0 | 1-102 | MSRIALLLVLAIVPCFCQRPFYAGIRPIGFPETPVVSGIFDRFSNEPIPAQLNGDRDYANRLNALPLENQPFFFVNREQVAANLNNP… |
| A0A1J1HJY7 | 1-112 | MKVQFLLPFMLISVINAQRGSYAGVRPIENGIKGPFPSPPPTNINNRFGDDSIGNGLPVDALGDYNLVNKLSQLPLNKQPFWLLNYQ… |
| A0A4C1VNG4 | 38-145 | None |
| A0A194PZ81 | 20-135 | None |
| A0A4C1VND3 | 55-174 | None |
| A0A835GUW6 | 1-117 | None |
| A0A6J1MRT3 | 3-115 | None |
| A0A811X264 | 3-137 | None |
| I4DKI1 | 4-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.