DPCstruct | MC23542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 161 ± 16 aa |
| Standard deviation of domain lengths | 15.69 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 25.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0131 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0P3H3 | 6-159 | ILDGIHGSVIKRRWAQVYTAFVRVLLGLAFIPPSIPKIMNQPFTVLPDSNPVGAYFNALYNTGFYYNFLGWSQLIAAILLLIPRTSH… |
| A0A519X6K2 | 170-333 | HLYLGIARYLLGIGMFPYAITKILRTQLVLSGYAWAQATPLESISSMTLTWAFLGHSWWFQVLLGFCELIPALLLLFRRTSLLGAIL… |
| A0A3D2XIF9 | 2-171 | None |
| A0A3M8CUU2 | 4-151 | None |
| A0A838Z1H5 | 70-217 | None |
| A0A3C0Z8B7 | 2-168 | None |
| A0A7X1NUE0 | 116-275 | None |
| A0A511NGS5 | 10-181 | None |
| A0A4Q0PGT7 | 7-151 | None |
| A0A4S3M107 | 8-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.