DPCstruct | MC2354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 183 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CLE8 | 25-196 | RLRQEEERDVDLLVNDLSDWVGVILKFEGILNWENPGLLVAILLLVTSVFMLFHLYSPTVLCTIGCFGLALSTIDYFGPTVSARLSH… |
| A0A7J7B5B8 | 2-187 | DDQETQTSILKDSFESWKEIILLVHSVLLWEKNWYPGAILGGTSFLFLTLWLVDASILSTLSILGLTITISDYVVPIVAAVMFKPES… |
| A0A3B0K2I9 | 5-175 | None |
| A0A5N5TFL3 | 3-209 | None |
| A0A7R9NZM3 | 40-218 | None |
| A0A6A5DAL7 | 196-400 | None |
| D3PIR8 | 5-187 | None |
| A0A151N172 | 9-203 | None |
| D6X2T5 | 35-225 | None |
| A0A1D1VJP9 | 235-417 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.