DPCstruct | MC23538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 154 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6F9CE59 | 17-182 | QRRREELERRDQQRLTELRRLMAEQANRDKERVQFREEALLQRREEREAQALQRLKEEEERGSRLEALRNQVAVVAEPDPERMMGDT… |
| A0A7J8JCE0 | 81-228 | LEELKKLMAEQSVKDRERVKYRQELLEKRLMEKNEVALQEAHEEAERERRLEALRKQVAIVAQFDPVRMMSDTVASKAKMGIGIEEE… |
| G0R345 | 45-191 | None |
| A0A507F7G7 | 320-493 | None |
| A0A498LP58 | 518-654 | None |
| T1EN45 | 5-150 | None |
| A0A7M5U7Z6 | 469-646 | None |
| A0A4Z2J2E3 | 39-165 | None |
| A0A6A4VQY7 | 4-206 | None |
| A0A267DF43 | 243-400 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.