DPCstruct | MC23537
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 226 ± 26 aa |
| Standard deviation of domain lengths | 25.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 33.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14775 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H2YV42 | 77-269 | INQLRAKMQQNSRECEDRNRRLREEREHVQTHFQQLKSEMNNNREADRAKLTQLTLQSNSAIKKLKKVCDKGEQILRLSEMCRKLET… |
| A0A7J8JB50 | 14-237 | LKGKIMVHSRESEEQNQYIRDDKELVHVQLRKLKAQRTQAREISQENLVKLTLESNATIKALRKIVDKGEKILKLAEICRKFETEEE… |
| A0A7S0TWR4 | 1-211 | None |
| A0A7S2RYX4 | 281-543 | None |
| A0A830HT48 | 39-301 | None |
| A0A7S2V114 | 6-252 | None |
| A0A654HHH5 | 178-413 | None |
| A0A7J8FWN3 | 130-358 | None |
| A0A813BMG4 | 938-1173 | None |
| A0A4P9YSJ3 | 238-445 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.