DPCstruct | MC23536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 141 ± 26 aa |
| Standard deviation of domain lengths | 25.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 68.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.40 |
| Pfam Score | 77.72 |
| Assigned Pfam label(s) | CL0229- PF01754 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8IV69 | 9-171 | PGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADASLNNCEGAAGSTSEKSRNVPVAAL… |
| A0A3M0K112 | 17-136 | GCGFYGSPRTNGMCSVCYKEFLQRQQSSDRISPPGTLLEISQNTAESKTASEKPKPKKNRCFTCRKKIGLTGFDCRCGNLFCAIHRY… |
| A0A6A6LH73 | 33-172 | None |
| M8B4E4 | 109-269 | None |
| A0A6J3CDX8 | 109-244 | None |
| A0A445HS49 | 237-390 | None |
| A0A5N6Q5G7 | 1-134 | None |
| A0A1B0C3F7 | 551-671 | None |
| A0A6A6N919 | 2-127 | None |
| A0A337SV80 | 1-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.